Lineage for d2f66e_ (2f66 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2304155Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 2304165Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins)
    includes structurally variable linker region
  6. 2304166Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species)
  7. 2304167Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries)
    Uniprot Q02767 15-125! Uniprot Q02767 23-123
  8. 2304171Domain d2f66e_: 2f66 E: [133031]
    Other proteins in same PDB: d2f66a1, d2f66a2, d2f66c1, d2f66d2, d2f66d3, d2f66f_
    automated match to d2f66b1
    complexed with so4

Details for d2f66e_

PDB Entry: 2f66 (more details), 2.8 Å

PDB Description: structure of the escrt-i endosomal trafficking complex
PDB Compounds: (E:) vacuolar protein sorting-associated protein vps28

SCOPe Domain Sequences for d2f66e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f66e_ a.2.17.2 (E:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh

SCOPe Domain Coordinates for d2f66e_:

Click to download the PDB-style file with coordinates for d2f66e_.
(The format of our PDB-style files is described here.)

Timeline for d2f66e_: