Lineage for d2f66e1 (2f66 E:15-125)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633776Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 633786Family a.2.17.2: VPS28 N-terminal domain [140115] (1 protein)
    includes structurally variable linker region
  6. 633787Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species)
  7. 633788Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries)
  8. 633792Domain d2f66e1: 2f66 E:15-125 [133031]
    Other proteins in same PDB: d2f66a1, d2f66c1, d2f66d1, d2f66f1
    automatically matched to 2F66 B:15-125
    complexed with so4; mutant

Details for d2f66e1

PDB Entry: 2f66 (more details), 2.8 Å

PDB Description: structure of the escrt-i endosomal trafficking complex
PDB Compounds: (E:) vacuolar protein sorting-associated protein vps28

SCOP Domain Sequences for d2f66e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f66e1 a.2.17.2 (E:15-125) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh

SCOP Domain Coordinates for d2f66e1:

Click to download the PDB-style file with coordinates for d2f66e1.
(The format of our PDB-style files is described here.)

Timeline for d2f66e1: