![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) ![]() forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
![]() | Family a.2.17.2: VPS28 N-terminal domain [140115] (1 protein) includes structurally variable linker region |
![]() | Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries) |
![]() | Domain d2f66b1: 2f66 B:15-125 [133028] Other proteins in same PDB: d2f66a1, d2f66c1, d2f66d1, d2f66f1 complexed with so4; mutant |
PDB Entry: 2f66 (more details), 2.8 Å
SCOP Domain Sequences for d2f66b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f66b1 a.2.17.2 (B:15-125) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
Timeline for d2f66b1: