SCOP 1.73: Domain d2f66b1: 2f66 B:15-125

Lineage for d2f66b1 (2f66 B:15-125)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.2: VPS28 N-terminal domain [140115] (1 protein)
   includes structurally variable linker region

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries)

8. Domain d2f66b1: 2f66 B:15-125 [133028]
   Other proteins in same PDB: d2f66a1, d2f66c1, d2f66d1, d2f66f1
   complexed with so4; mutant

Details for d2f66b1

PDB Entry: 2f66, 2.8 Å

PDB Description: structure of the escrt-i endosomal trafficking complex

PDB Compounds: (B:) vacuolar protein sorting-associated protein vps28

SCOP Domain Sequences for d2f66b1:

Sequence; same for both SEQRES and ATOM records:

>d2f66b1 a.2.17.2 (B:15-125) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh

Timeline for d2f66b1:

• d2f66b1 is new in SCOP 1.73
  
• d2f66b1 appears in SCOP 1.75
  
• d2f66b1 appears in the current release, SCOPe 2.08