![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (3 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins) |
![]() | Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species) class II N-deoxyribosyltransferase |
![]() | Species Trypanosoma brucei [TaxId:5691] [142064] (5 PDB entries) |
![]() | Domain d2f64a1: 2f64 A:9-160 [133024] automatically matched to 2A0K A:9-160 complexed with 12q, gol, so4 |
PDB Entry: 2f64 (more details), 1.6 Å
SCOP Domain Sequences for d2f64a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f64a1 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]} mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg fglpfnlmlydgvevfdsfesafkyflanfps
Timeline for d2f64a1: