Lineage for d2f64a2 (2f64 A:9-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858402Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 2858403Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 2858409Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142064] (5 PDB entries)
    Uniprot Q57VC7 1-152
  8. 2858412Domain d2f64a2: 2f64 A:9-160 [133024]
    Other proteins in same PDB: d2f64a3, d2f64b3
    automated match to d2a0ka1
    complexed with 12q, gol, so4

Details for d2f64a2

PDB Entry: 2f64 (more details), 1.6 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.6 a resolution with 1-methylquinolin-2(1h)-one bound
PDB Compounds: (A:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d2f64a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f64a2 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc
daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg
fglpfnlmlydgvevfdsfesafkyflanfps

SCOPe Domain Coordinates for d2f64a2:

Click to download the PDB-style file with coordinates for d2f64a2.
(The format of our PDB-style files is described here.)

Timeline for d2f64a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f64a3