SCOP 1.73: Domain d2f63a1: 2f63 A:1-158

Lineage for d2f63a1 (2f63 A:1-158)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)

7. Species Escherichia coli [TaxId:562] [55086] (19 PDB entries)

8. Domain d2f63a1: 2f63 A:1-158 [133023]
   automatically matched to d1dy3a_

Details for d2f63a1

PDB Entry: 2f63

PDB Description: solution structure of hppk in complex with inhibitor analogs ampcpp and hp-1

PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOP Domain Sequences for d2f63a1:

Sequence; same for both SEQRES and ATOM records:

>d2f63a1 d.58.30.1 (A:1-158) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d2f63a1:

• d2f63a1 is new in SCOP 1.73
  
• d2f63a1 appears in SCOP 1.75
  
• d2f63a1 appears in the current release, SCOPe 2.08, called d2f63a_