Lineage for d2f63a1 (2f63 A:1-158)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725724Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 725725Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 725726Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 725727Species Escherichia coli [TaxId:562] [55086] (19 PDB entries)
  8. 725747Domain d2f63a1: 2f63 A:1-158 [133023]
    automatically matched to d1dy3a_

Details for d2f63a1

PDB Entry: 2f63 (more details)

PDB Description: Solution structure of HPPK in complex with inhibitor analogs AMPCPP and HP-1
PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOP Domain Sequences for d2f63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f63a1 d.58.30.1 (A:1-158) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d2f63a1:

Click to download the PDB-style file with coordinates for d2f63a1.
(The format of our PDB-style files is described here.)

Timeline for d2f63a1: