Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) common fold is elaborated with additional secondary structures automatically mapped to Pfam PF01288 |
Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species) |
Species Escherichia coli [TaxId:562] [55086] (49 PDB entries) Uniprot P26281 |
Domain d2f63a_: 2f63 A: [133023] automated match to d3ip0a_ |
PDB Entry: 2f63 (more details)
SCOPe Domain Sequences for d2f63a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f63a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]} tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d2f63a_: