Lineage for d2f63a_ (2f63 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521759Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
    automatically mapped to Pfam PF01288
  5. 2521760Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (2 proteins)
  6. 2521761Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)
  7. 2521767Species Escherichia coli [TaxId:562] [55086] (42 PDB entries)
    Uniprot P26281
  8. 2521808Domain d2f63a_: 2f63 A: [133023]
    automated match to d3ip0a_

Details for d2f63a_

PDB Entry: 2f63 (more details)

PDB Description: Solution structure of HPPK in complex with inhibitor analogs AMPCPP and HP-1
PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d2f63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f63a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOPe Domain Coordinates for d2f63a_:

Click to download the PDB-style file with coordinates for d2f63a_.
(The format of our PDB-style files is described here.)

Timeline for d2f63a_: