SCOPe 2.04: Domain d2f62a_: 2f62 A:

Lineage for d2f62a_ (2f62 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)

6. Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
   class II N-deoxyribosyltransferase

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142064] (5 PDB entries)
   Uniprot Q57VC7 1-152

8. Domain d2f62a_: 2f62 A: [133021]
   automated match to d2a0ka1
   complexed with 12m, gol, so4

Details for d2f62a_

PDB Entry: 2f62, 1.5 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.5 a resolution with (2-ethylphenyl)methanol bound

PDB Compounds: (A:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d2f62a_:

Sequence; same for both SEQRES and ATOM records:

>d2f62a_ c.23.14.1 (A:) Nucleoside 2-deoxyribosyltransferase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
nlrvegfglpfnlmlydgvevfdsfesafkyflanfps

Timeline for d2f62a_:

• d2f62a_ first appeared in SCOP 1.73, called d2f62a1
  
• d2f62a_ appears in SCOPe 2.03
  
• d2f62a_ appears in SCOPe 2.05
  
• d2f62a_ appears in the current release, SCOPe 2.08, called d2f62a2