Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Glucosylceramidase [89389] (1 species) glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core |
Species Human (Homo sapiens) [TaxId:9606] [89390] (11 PDB entries) |
Domain d2f61b1: 2f61 B:1-77,B:432-497 [133019] Other proteins in same PDB: d2f61a2, d2f61b2 automatically matched to d1ogsa1 complexed with nag, ndg, so4 |
PDB Entry: 2f61 (more details), 2.5 Å
SCOP Domain Sequences for d2f61b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f61b1 b.71.1.2 (B:1-77,B:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik dpavgfletispgysihtylwhrq
Timeline for d2f61b1: