SCOP 1.75: Domain d2f61b1: 2f61 B:1-77,B:432-497

Lineage for d2f61b1 (2f61 B:1-77,B:432-497)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Glucosylceramidase [89389] (1 species)
   glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core

7. Species Human (Homo sapiens) [TaxId:9606] [89390] (11 PDB entries)

8. Domain d2f61b1: 2f61 B:1-77,B:432-497 [133019]
   Other proteins in same PDB: d2f61a2, d2f61b2
   automatically matched to d1ogsa1
   complexed with nag, ndg, so4

Details for d2f61b1

PDB Entry: 2f61, 2.5 Å

PDB Description: crystal structure of partially deglycosylated acid beta-glucosidase

PDB Compounds: (B:) Acid beta-glucosidase

SCOP Domain Sequences for d2f61b1:

Sequence; same for both SEQRES and ATOM records:

>d2f61b1 b.71.1.2 (B:1-77,B:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

Timeline for d2f61b1:

• d2f61b1 first appeared in SCOP 1.73
  
• d2f61b1 appears in SCOPe 2.01
  
• d2f61b1 appears in the current release, SCOPe 2.08