Lineage for d2f61a2 (2f61 A:78-431)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830990Protein Glucosylceramidase, catalytic domain [89473] (1 species)
    acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases
  7. 2830991Species Human (Homo sapiens) [TaxId:9606] [89474] (23 PDB entries)
  8. 2831044Domain d2f61a2: 2f61 A:78-431 [133018]
    Other proteins in same PDB: d2f61a1, d2f61b1
    automated match to d1ogsa2
    complexed with nag, so4

Details for d2f61a2

PDB Entry: 2f61 (more details), 2.5 Å

PDB Description: crystal structure of partially deglycosylated acid beta-glucosidase
PDB Compounds: (A:) Acid beta-glucosidase

SCOPe Domain Sequences for d2f61a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f61a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

SCOPe Domain Coordinates for d2f61a2:

Click to download the PDB-style file with coordinates for d2f61a2.
(The format of our PDB-style files is described here.)

Timeline for d2f61a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f61a1