Lineage for d2f5yb_ (2f5y B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786047Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)
  7. 1786048Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry)
    Uniprot P49796 300-376
  8. 1786050Domain d2f5yb_: 2f5y B: [133016]
    automated match to d2f5ya1
    complexed with so4

Details for d2f5yb_

PDB Entry: 2f5y (more details), 2.39 Å

PDB Description: Crystal Structure of the PDZ Domain from Human RGS-3
PDB Compounds: (B:) regulator of G-protein signalling 3 isoform 1

SCOPe Domain Sequences for d2f5yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5yb_ b.36.1.1 (B:) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}
mryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkc
velaheirscpseiillvwrmv

SCOPe Domain Coordinates for d2f5yb_:

Click to download the PDB-style file with coordinates for d2f5yb_.
(The format of our PDB-style files is described here.)

Timeline for d2f5yb_: