SCOPe 2.05: Domain d2f5yb_: 2f5y B:

Lineage for d2f5yb_ (2f5y B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry)
   Uniprot P49796 300-376

8. Domain d2f5yb_: 2f5y B: [133016]
   automated match to d2f5ya1
   complexed with so4

Details for d2f5yb_

PDB Entry: 2f5y, 2.39 Å

PDB Description: Crystal Structure of the PDZ Domain from Human RGS-3

PDB Compounds: (B:) regulator of G-protein signalling 3 isoform 1

SCOPe Domain Sequences for d2f5yb_:

Sequence; same for both SEQRES and ATOM records:

>d2f5yb_ b.36.1.1 (B:) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]}
mryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkc
velaheirscpseiillvwrmv

Timeline for d2f5yb_:

• d2f5yb_ first appeared in SCOP 1.73, called d2f5yb1
  
• d2f5yb_ appears in SCOPe 2.04
  
• d2f5yb_ is called d2f5yb2 in SCOPe 2.06
  
• d2f5yb_ appears in the current release, SCOPe 2.08, called d2f5yb2