Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141264] (1 PDB entry) Uniprot P49796 300-376 |
Domain d2f5ya1: 2f5y A:19-95 [133015] complexed with so4 |
PDB Entry: 2f5y (more details), 2.39 Å
SCOPe Domain Sequences for d2f5ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} itiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkcvelah eirscpseiillvwrmv
Timeline for d2f5ya1: