Lineage for d2f5va1 (2f5v A:43-354,A:553-619)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849689Protein Pyranose 2-oxidase [117439] (1 species)
  7. 2849690Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries)
    Uniprot Q8J136 43-619
  8. 2849691Domain d2f5va1: 2f5v A:43-354,A:553-619 [133010]
    Other proteins in same PDB: d2f5va2
    automatically matched to d1tzla1
    complexed with fad, kbg, peg, pg4; mutant

Details for d2f5va1

PDB Entry: 2f5v (more details), 1.41 Å

PDB Description: reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp.
PDB Compounds: (A:) Pyranose 2-oxidase

SCOPe Domain Sequences for d2f5va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
tnppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam
slaiksceyikqnftpspft

SCOPe Domain Coordinates for d2f5va1:

Click to download the PDB-style file with coordinates for d2f5va1.
(The format of our PDB-style files is described here.)

Timeline for d2f5va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5va2