Lineage for d2f5sa3 (2f5s A:229-274)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035992Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 3035993Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 3035994Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries)
  8. 3036012Domain d2f5sa3: 2f5s A:229-274 [133009]
    Other proteins in same PDB: d2f5sa1, d2f5sa2
    automatically matched to d1r2ya3
    protein/DNA complex; complexed with zn

Details for d2f5sa3

PDB Entry: 2f5s (more details), 2.35 Å

PDB Description: catalytically inactive (e3q) mutm crosslinked to oxog:c containing dna cc1
PDB Compounds: (A:) formamidopyrimidine-DNA glycosidase

SCOPe Domain Sequences for d2f5sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5sa3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d2f5sa3:

Click to download the PDB-style file with coordinates for d2f5sa3.
(The format of our PDB-style files is described here.)

Timeline for d2f5sa3: