Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
Domain d2f5sa1: 2f5s A:135-228 [133007] Other proteins in same PDB: d2f5sa2, d2f5sa3 automatically matched to d1r2ya1 protein/DNA complex; complexed with zn |
PDB Entry: 2f5s (more details), 2.35 Å
SCOPe Domain Sequences for d2f5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5sa1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavmkggstvrtyvnt
Timeline for d2f5sa1: