Lineage for d2f5sa1 (2f5s A:135-228)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284575Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1284576Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1284651Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 1284652Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 1284653Species Bacillus stearothermophilus [TaxId:1422] [81611] (9 PDB entries)
  8. 1284662Domain d2f5sa1: 2f5s A:135-228 [133007]
    Other proteins in same PDB: d2f5sa2, d2f5sa3
    automatically matched to d1r2ya1
    protein/DNA complex; complexed with zn

Details for d2f5sa1

PDB Entry: 2f5s (more details), 2.35 Å

PDB Description: catalytically inactive (e3q) mutm crosslinked to oxog:c containing dna cc1
PDB Compounds: (A:) formamidopyrimidine-DNA glycosidase

SCOPe Domain Sequences for d2f5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5sa1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

SCOPe Domain Coordinates for d2f5sa1:

Click to download the PDB-style file with coordinates for d2f5sa1.
(The format of our PDB-style files is described here.)

Timeline for d2f5sa1: