Class b: All beta proteins [48724] (165 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81612] (9 PDB entries) |
Domain d2f5qa2: 2f5q A:2-134 [133005] Other proteins in same PDB: d2f5qa1, d2f5qa3 automatically matched to d1r2ya2 complexed with 8og, zn; mutant |
PDB Entry: 2f5q (more details), 2.35 Å
SCOP Domain Sequences for d2f5qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5qa2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d2f5qa2: