Lineage for d2f5qa2 (2f5q A:2-134)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679457Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 679458Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 679459Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 679460Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 679461Species Bacillus stearothermophilus [TaxId:1422] [81612] (9 PDB entries)
  8. 679468Domain d2f5qa2: 2f5q A:2-134 [133005]
    Other proteins in same PDB: d2f5qa1, d2f5qa3
    automatically matched to d1r2ya2
    complexed with 8og, zn; mutant

Details for d2f5qa2

PDB Entry: 2f5q (more details), 2.35 Å

PDB Description: catalytically inactive (e3q) mutm crosslinked to oxog:c containing dna cc2
PDB Compounds: (A:) formamidopyrimidine-DNA glycosidase

SCOP Domain Sequences for d2f5qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5qa2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOP Domain Coordinates for d2f5qa2:

Click to download the PDB-style file with coordinates for d2f5qa2.
(The format of our PDB-style files is described here.)

Timeline for d2f5qa2: