Lineage for d2f5mb_ (2f5m B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2530966Protein Barnase [81305] (1 species)
  7. 2530967Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2530994Domain d2f5mb_: 2f5m B: [133002]
    automated match to d1b27a_
    complexed with brj

Details for d2f5mb_

PDB Entry: 2f5m (more details), 1.95 Å

PDB Description: Cross-linked barnase soaked in bromo-ethanol
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2f5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5mb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d2f5mb_:

Click to download the PDB-style file with coordinates for d2f5mb_.
(The format of our PDB-style files is described here.)

Timeline for d2f5mb_: