SCOP 1.73: Domain d2f5mb1: 2f5m B:1-108

Lineage for d2f5mb1 (2f5m B:1-108)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d2f5mb1: 2f5m B:1-108 [133002]
   automatically matched to d1b27a_
   complexed with brj

Details for d2f5mb1

PDB Entry: 2f5m, 1.95 Å

PDB Description: Cross-linked barnase soaked in bromo-ethanol

PDB Compounds: (B:) Ribonuclease

SCOP Domain Sequences for d2f5mb1:

Sequence; same for both SEQRES and ATOM records:

>d2f5mb1 d.1.1.2 (B:1-108) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d2f5mb1:

• d2f5mb1 is new in SCOP 1.73
  
• d2f5mb1 appears in SCOP 1.75
  
• d2f5mb1 appears in the current release, SCOPe 2.08, called d2f5mb_