SCOPe 2.08: Domain d2f5mb_: 2f5m B:

Lineage for d2f5mb_ (2f5m B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d2f5mb_: 2f5m B: [133002]
   automated match to d1b27a_
   complexed with brj

Details for d2f5mb_

PDB Entry: 2f5m, 1.95 Å

PDB Description: Cross-linked barnase soaked in bromo-ethanol

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2f5mb_:

Sequence; same for both SEQRES and ATOM records:

>d2f5mb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d2f5mb_:

• d2f5mb_ first appeared in SCOP 1.73, called d2f5mb1
  
• d2f5mb_ appears in SCOPe 2.07