![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.3: Chromo barrel domain [117157] (4 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
![]() | Protein automated matches [190429] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187320] (1 PDB entry) |
![]() | Domain d2f5ke_: 2f5k E: [132999] Other proteins in same PDB: d2f5ka1 automated match to d2efia1 |
PDB Entry: 2f5k (more details), 2.2 Å
SCOPe Domain Sequences for d2f5ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5ke_ b.34.13.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky vdtnlqkqrelqkanqeq
Timeline for d2f5ke_: