Lineage for d2f5kc1 (2f5k C:7-86)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665974Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 666066Family b.34.13.3: Chromo barrel domain [117157] (3 protein domains)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 666067Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
    MORF-related gene 15 isoform 1
  7. 666068Species Human (Homo sapiens) [TaxId:9606] [141226] (1 PDB entry)
  8. 666071Domain d2f5kc1: 2f5k C:7-86 [132997]
    automatically matched to 2F5K A:6-88

Details for d2f5kc1

PDB Entry: 2f5k (more details), 2.2 Å

PDB Description: Crystal structure of the chromo domain of human MRG15
PDB Compounds: (C:) MORF-related gene 15 isoform 1

SCOP Domain Sequences for d2f5kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5kc1 b.34.13.3 (C:7-86) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
pkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlkyv
dtnlqkqrelqkanqeqyae

SCOP Domain Coordinates for d2f5kc1:

Click to download the PDB-style file with coordinates for d2f5kc1.
(The format of our PDB-style files is described here.)

Timeline for d2f5kc1: