SCOPe 2.01: Domain d2f5kb_: 2f5k B:

Lineage for d2f5kb_ (2f5k B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein automated matches [190429] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187320] (1 PDB entry)

8. Domain d2f5kb_: 2f5k B: [132996]
   Other proteins in same PDB: d2f5ka1
   automated match to d2efia1

Details for d2f5kb_

PDB Entry: 2f5k, 2.2 Å

PDB Description: crystal structure of the chromo domain of human mrg15

PDB Compounds: (B:) MORF-related gene 15 isoform 1

SCOPe Domain Sequences for d2f5kb_:

Sequence; same for both SEQRES and ATOM records:

>d2f5kb_ b.34.13.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeqyaegkmr

Timeline for d2f5kb_:

• d2f5kb_ first appeared in SCOP 1.73, called d2f5kb1
  
• d2f5kb_ was called d2f5kb1 in SCOP 1.75
  
• d2f5kb_ appears in SCOPe 2.02
  
• d2f5kb_ appears in the current release, SCOPe 2.08