![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.3: Chromo barrel domain [117157] (3 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
![]() | Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species) MORF-related gene 15 isoform 1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141226] (2 PDB entries) Uniprot Q9UBU8 6-88 |
![]() | Domain d2f5kb1: 2f5k B:6-88 [132996] automatically matched to 2F5K A:6-88 |
PDB Entry: 2f5k (more details), 2.2 Å
SCOP Domain Sequences for d2f5kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5kb1 b.34.13.3 (B:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky vdtnlqkqrelqkanqeqyaegk
Timeline for d2f5kb1: