![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Manganese transport regulator MntR [89086] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries) |
![]() | Domain d2f5ea2: 2f5e A:63-136 [132984] Other proteins in same PDB: d2f5ea1, d2f5eb1 automated match to d1on1a2 complexed with mn |
PDB Entry: 2f5e (more details), 2.2 Å
SCOPe Domain Sequences for d2f5ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5ea2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkk
Timeline for d2f5ea2: