Lineage for d2f56c_ (2f56 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923796Protein Barnase [81305] (1 species)
  7. 2923797Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2923871Domain d2f56c_: 2f56 C: [132976]
    automated match to d1b27a_
    complexed with ure, zn

Details for d2f56c_

PDB Entry: 2f56 (more details), 1.96 Å

PDB Description: barnase cross-linked with glutaraldehyde soaked in 6m urea
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d2f56c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f56c_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d2f56c_:

Click to download the PDB-style file with coordinates for d2f56c_.
(The format of our PDB-style files is described here.)

Timeline for d2f56c_: