Lineage for d2f54f2 (2f54 F:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937811Domain d2f54f2: 2f54 F:1-181 [132972]
    Other proteins in same PDB: d2f54a1, d2f54b2, d2f54b3, d2f54d1, d2f54d2, d2f54e1, d2f54e2, d2f54f1, d2f54g2, d2f54g3, d2f54k1, d2f54k2, d2f54l1, d2f54l2
    automatically matched to d1akja2

Details for d2f54f2

PDB Entry: 2f54 (more details), 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
PDB Compounds: (F:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2f54f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f54f2 d.19.1.1 (F:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2f54f2:

Click to download the PDB-style file with coordinates for d2f54f2.
(The format of our PDB-style files is described here.)

Timeline for d2f54f2: