![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (388 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d2f54b_: 2f54 B: [132970] Other proteins in same PDB: d2f54a1, d2f54a2, d2f54d1, d2f54d2, d2f54e1, d2f54e2, d2f54f1, d2f54f2, d2f54k1, d2f54k2, d2f54l1, d2f54l2 automated match to d1ao7b_ |
PDB Entry: 2f54 (more details), 2.7 Å
SCOPe Domain Sequences for d2f54b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f54b_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllycteftptekdeyacrvnhvtlsqpcivkwdrdm
Timeline for d2f54b_: