SCOP 1.73: Domain d2f54a2: 2f54 A:1-181

Lineage for d2f54a2 (2f54 A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)

8. Domain d2f54a2: 2f54 A:1-181 [132969]
   Other proteins in same PDB: d2f54a1, d2f54b1, d2f54f1, d2f54g1
   automatically matched to d1akja2
   mutant

Details for d2f54a2

PDB Entry: 2f54, 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity

PDB Compounds: (A:) hla class I histocompatibility antigen

SCOP Domain Sequences for d2f54a2:

Sequence; same for both SEQRES and ATOM records:

>d2f54a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2f54a2:

• d2f54a2 is new in SCOP 1.73
  
• d2f54a2 appears in SCOP 1.75
  
• d2f54a2 appears in the current release, SCOPe 2.08