SCOPe 2.01: Domain d2f54a1: 2f54 A:182-274

Lineage for d2f54a1 (2f54 A:182-274)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2f54a1: 2f54 A:182-274 [132968]
   Other proteins in same PDB: d2f54a2, d2f54b_, d2f54d1, d2f54d2, d2f54e1, d2f54e2, d2f54f2, d2f54g_, d2f54k1, d2f54k2, d2f54l1, d2f54l2
   automatically matched to d1akja1

Details for d2f54a1

PDB Entry: 2f54, 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity

PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2f54a1:

Sequence; same for both SEQRES and ATOM records:

>d2f54a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d2f54a1:

• d2f54a1 first appeared in SCOP 1.73
  
• d2f54a1 appears in SCOP 1.75
  
• d2f54a1 appears in SCOPe 2.02
  
• d2f54a1 appears in the current release, SCOPe 2.08