Lineage for d2f53a2 (2f53 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544816Domain d2f53a2: 2f53 A:1-181 [132967]
    Other proteins in same PDB: d2f53a1, d2f53b1, d2f53b2, d2f53d1, d2f53d2, d2f53e1, d2f53e2
    automatically matched to d1akja2
    complexed with gol, na

Details for d2f53a2

PDB Entry: 2f53 (more details), 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2f53a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f53a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2f53a2:

Click to download the PDB-style file with coordinates for d2f53a2.
(The format of our PDB-style files is described here.)

Timeline for d2f53a2: