Lineage for d2f52a1 (2f52 A:1-67)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668363Protein Major cold shock protein [50283] (4 species)
  7. 668379Species Bacillus subtilis [TaxId:1423] [50285] (6 PDB entries)
  8. 668383Domain d2f52a1: 2f52 A:1-67 [132965]
    automatically matched to d1csp__

Details for d2f52a1

PDB Entry: 2f52 (more details)

PDB Description: Solution structure of cold shock protein CspB from Bacillus subtilis in complex with heptathymidine
PDB Compounds: (A:) Cold shock protein cspB

SCOP Domain Sequences for d2f52a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f52a1 b.40.4.5 (A:1-67) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOP Domain Coordinates for d2f52a1:

Click to download the PDB-style file with coordinates for d2f52a1.
(The format of our PDB-style files is described here.)

Timeline for d2f52a1: