Lineage for d2f52a_ (2f52 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2383220Protein Major cold shock protein [50283] (4 species)
  7. 2383238Species Bacillus subtilis [TaxId:1423] [50285] (10 PDB entries)
  8. 2383248Domain d2f52a_: 2f52 A: [132965]
    automated match to d3pf5b_
    protein/DNA complex

Details for d2f52a_

PDB Entry: 2f52 (more details)

PDB Description: Solution structure of cold shock protein CspB from Bacillus subtilis in complex with heptathymidine
PDB Compounds: (A:) Cold shock protein cspB

SCOPe Domain Sequences for d2f52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f52a_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOPe Domain Coordinates for d2f52a_:

Click to download the PDB-style file with coordinates for d2f52a_.
(The format of our PDB-style files is described here.)

Timeline for d2f52a_: