Lineage for d2f4zb_ (2f4z B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938977Protein Hypothetical protein Tgtwinscan_2721, E2 domain [143066] (1 species)
  7. 2938978Species Toxoplasma gondii [TaxId:5811] [143067] (1 PDB entry)
  8. 2938980Domain d2f4zb_: 2f4z B: [132964]
    automated match to d2f4za1
    complexed with gol, unx

Details for d2f4zb_

PDB Entry: 2f4z (more details), 2.11 Å

PDB Description: Toxoplasma gondii ubiquitin conjugating enzyme TgTwinScan_2721- E2 domain
PDB Compounds: (B:) TgTwinScan_2721 - E2 domain

SCOPe Domain Sequences for d2f4zb_:

Sequence, based on SEQRES records: (download)

>d2f4zb_ d.20.1.1 (B:) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]}
eqarllkeladiqqlqrahdsepaathstshgvsaqivggdihrwrgfiagplgtpyegg
hftldivippdypynppkmkfvtkiwhpnissqtgaicldilkhewspaltirtallsiq
amladpvptdpqdaevakmmienhplfvqtaklwtetfak

Sequence, based on observed residues (ATOM records): (download)

>d2f4zb_ d.20.1.1 (B:) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]}
eqarllkeladiqqgvsaqivggdihrwrgfiagplgtpyegghftldivippdypynpp
kmkfvtkiwhpnissqtgaicldilkhewspaltirtallsiqamladpvptdpqdaeva
kmmienhplfvqtaklwtetfak

SCOPe Domain Coordinates for d2f4zb_:

Click to download the PDB-style file with coordinates for d2f4zb_.
(The format of our PDB-style files is described here.)

Timeline for d2f4zb_: