Lineage for d2f4za1 (2f4z A:32-192)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720008Protein Hypothetical protein Tgtwinscan_2721, E2 domain [143066] (1 species)
  7. 720009Species Toxoplasma gondii [TaxId:5811] [143067] (1 PDB entry)
  8. 720010Domain d2f4za1: 2f4z A:32-192 [132963]
    complexed with gol, unx

Details for d2f4za1

PDB Entry: 2f4z (more details), 2.11 Å

PDB Description: Toxoplasma gondii ubiquitin conjugating enzyme TgTwinScan_2721- E2 domain
PDB Compounds: (A:) TgTwinScan_2721 - E2 domain

SCOP Domain Sequences for d2f4za1:

Sequence, based on SEQRES records: (download)

>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]}
reqarllkeladiqqlqrahdsepaathstshgvsaqivggdihrwrgfiagplgtpyeg
ghftldivippdypynppkmkfvtkiwhpnissqtgaicldilkhewspaltirtallsi
qamladpvptdpqdaevakmmienhplfvqtaklwtetfak

Sequence, based on observed residues (ATOM records): (download)

>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]}
reqarllkeladiqqlgvsaqivggdihrwrgfiagplgtpyegghftldivippdypyn
ppkmkfvtkiwhpnissqtgaicldilkhewspaltirtallsiqamladpvptdpqdae
vakmmienhplfvqtaklwtetfak

SCOP Domain Coordinates for d2f4za1:

Click to download the PDB-style file with coordinates for d2f4za1.
(The format of our PDB-style files is described here.)

Timeline for d2f4za1: