Lineage for d2f4wa1 (2f4w A:12-168)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898367Species Human (Homo sapiens), E2 J2 [TaxId:9606] [143050] (1 PDB entry)
    Uniprot Q5T7L1 12-168
    ubc6 homologue
  8. 1898368Domain d2f4wa1: 2f4w A:12-168 [132958]

Details for d2f4wa1

PDB Entry: 2f4w (more details), 2 Å

PDB Description: Human ubiquitin-conjugating enzyme E2 J2
PDB Compounds: (A:) ubiquitin-conjugating enzyme E2, J2

SCOPe Domain Sequences for d2f4wa1:

Sequence, based on SEQRES records: (download)

>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]}
tatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeggyyhgklifpref
pfkppsiymitpngrfkcntrlclsitdfhpdtwnpawsvstiltgllsfmvekgptlgs
ietsdftkrqlavqslafnlkdkvfcelfpevveeik

Sequence, based on observed residues (ATOM records): (download)

>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]}
tatqrlkqdylrikkdpvpyicaeplpsnilewhyvvrgpemtpyeggyyhgklifpref
pfkppsiymitpngrfkcntrlcwnpawsvstiltgllsfmvekgptlgsietsdftkrq
lavqslafnlkdkvfcelfpevveeik

SCOPe Domain Coordinates for d2f4wa1:

Click to download the PDB-style file with coordinates for d2f4wa1.
(The format of our PDB-style files is described here.)

Timeline for d2f4wa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f4wb_