Lineage for d2f4vr1 (2f4v R:16-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636073Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 636074Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 636075Protein Ribosomal protein S18 [46913] (1 species)
  7. 636076Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries)
  8. 636103Domain d2f4vr1: 2f4v R:16-88 [132955]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vs1, d2f4vt1
    automatically matched to d1i94r_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vr1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d2f4vr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d2f4vr1:

Click to download the PDB-style file with coordinates for d2f4vr1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vr1: