Lineage for d2f4vm1 (2f4v M:2-126)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735303Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2735304Protein Ribosomal protein S13 [46948] (2 species)
  7. 2735332Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 2735363Domain d2f4vm1: 2f4v M:2-126 [132950]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgm_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vm1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2f4vm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2f4vm1:

Click to download the PDB-style file with coordinates for d2f4vm1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vm1: