Lineage for d2f4vi1 (2f4v I:2-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930174Protein Ribosomal protein S9 [54218] (2 species)
  7. 2930202Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2930231Domain d2f4vi1: 2f4v I:2-128 [132946]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgi_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vi1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2f4vi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vi1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d2f4vi1:

Click to download the PDB-style file with coordinates for d2f4vi1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vi1: