Lineage for d2f4vh1 (2f4v H:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978288Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2978323Domain d2f4vh1: 2f4v H:1-138 [132945]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgh_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vh1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2f4vh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2f4vh1:

Click to download the PDB-style file with coordinates for d2f4vh1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vh1: