![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
![]() | Domain d2f4vf1: 2f4v F:1-101 [132943] Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1 automatically matched to d1fjgf_ complexed with ab9, d2c, k, mg, zn |
PDB Entry: 2f4v (more details), 3.8 Å
SCOPe Domain Sequences for d2f4vf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4vf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2f4vf1: