SCOPe 2.08: Domain d2f4ve1: 2f4v E:74-154

Lineage for d2f4ve1 (2f4v E:74-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2f4ve1: 2f4v E:74-154 [132941]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1i94e1
   complexed with ab9, d2c, k, mg, zn

Details for d2f4ve1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2f4ve1:

Sequence; same for both SEQRES and ATOM records:

>d2f4ve1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2f4ve1:

• d2f4ve1 first appeared in SCOP 1.73
  
• d2f4ve1 appears in SCOPe 2.07