SCOP 1.73: Domain d2f4pd1: 2f4p D:3-135

Lineage for d2f4pd1 (2f4p D:3-135)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.9: TM1287-like [89409] (4 proteins)

6. Protein Hypothetical protein TM1010 [141589] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141590] (1 PDB entry)

8. Domain d2f4pd1: 2f4p D:3-135 [132936]
   automatically matched to 2F4P A:2-135
   complexed with edo, unl

Details for d2f4pd1

PDB Entry: 2f4p, 1.9 Å

PDB Description: Crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 A resolution

PDB Compounds: (D:) hypothetical protein TM1010

SCOP Domain Sequences for d2f4pd1:

Sequence; same for both SEQRES and ATOM records:

>d2f4pd1 b.82.1.9 (D:3-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]}
ddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqiliv
trgkgfyqergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgs
vteeeyrkategk

Timeline for d2f4pd1:

• d2f4pd1 is new in SCOP 1.73
  
• d2f4pd1 appears in SCOP 1.75
  
• d2f4pd1 appears in the current release, SCOPe 2.08, called d2f4pd_