Lineage for d2f4ob_ (2f4o B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752940Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 1752941Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 1752942Family a.189.1.1: XPC-binding domain [101239] (4 proteins)
  6. 1752954Protein automated matches [190283] (2 species)
    not a true protein
  7. 1752957Species Mouse (Mus musculus) [TaxId:10090] [187083] (2 PDB entries)
  8. 1752959Domain d2f4ob_: 2f4o B: [132932]
    Other proteins in same PDB: d2f4oa_
    automated match to d1pvea_
    complexed with cl, zn

Details for d2f4ob_

PDB Entry: 2f4o (more details), 2.26 Å

PDB Description: the mouse pngase-hr23 complex reveals a complete remodulation of the protein-protein interface compared to its yeast orthologs
PDB Compounds: (B:) XP-C repair complementing complex 58 kDa protein

SCOPe Domain Sequences for d2f4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ob_ a.189.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
g

SCOPe Domain Coordinates for d2f4ob_:

Click to download the PDB-style file with coordinates for d2f4ob_.
(The format of our PDB-style files is described here.)

Timeline for d2f4ob_: