Lineage for d2f4mb_ (2f4m B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927481Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 927482Superfamily a.189.1: XPC-binding domain [101238] (1 family) (S)
  5. 927483Family a.189.1.1: XPC-binding domain [101239] (4 proteins)
  6. 927495Protein automated matches [190283] (2 species)
    not a true protein
  7. 927498Species Mouse (Mus musculus) [TaxId:10090] [187083] (2 PDB entries)
  8. 927499Domain d2f4mb_: 2f4m B: [132931]
    Other proteins in same PDB: d2f4ma1
    automated match to d1pvea_
    complexed with cl, zn

Details for d2f4mb_

PDB Entry: 2f4m (more details), 1.85 Å

PDB Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs
PDB Compounds: (B:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d2f4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4mb_ a.189.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv
g

SCOPe Domain Coordinates for d2f4mb_:

Click to download the PDB-style file with coordinates for d2f4mb_.
(The format of our PDB-style files is described here.)

Timeline for d2f4mb_: