Lineage for d2f4ld_ (2f4l D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779511Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779556Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) (S)
    decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243
  5. 1779557Family b.23.3.1: Acetamidase/Formamidase-like [141131] (1 protein)
    Pfam PF03069
  6. 1779558Protein Putative acetamidase TM0119 [141132] (1 species)
  7. 1779559Species Thermotoga maritima [TaxId:2336] [141133] (1 PDB entry)
    Uniprot Q9WXX3 1-283
  8. 1779563Domain d2f4ld_: 2f4l D: [132930]
    automated match to d2f4la1
    complexed with cl, zn

Details for d2f4ld_

PDB Entry: 2f4l (more details), 2.5 Å

PDB Description: Crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 A resolution
PDB Compounds: (D:) acetamidase, putative

SCOPe Domain Sequences for d2f4ld_:

Sequence, based on SEQRES records: (download)

>d2f4ld_ b.23.3.1 (D:) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
hmkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfskvnpatgpvfvn
gvkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripi
hpmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmg
dgevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwf
iqrrktipftdaymlaslsvdvgisqlvnpaktakaripkyift

Sequence, based on observed residues (ATOM records): (download)

>d2f4ld_ b.23.3.1 (D:) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
hmkvvpaqrcvysfsanmapveevypgeqvvfetldalgvnpatgpvfvngvkpgdtlkv
rikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvigva
pqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvsace
vpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrktipft
daymlaslsvdvgisqlvnpaktakaripkyift

SCOPe Domain Coordinates for d2f4ld_:

Click to download the PDB-style file with coordinates for d2f4ld_.
(The format of our PDB-style files is described here.)

Timeline for d2f4ld_: