Lineage for d2f4lc1 (2f4l C:1-283)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662905Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662938Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (1 family) (S)
    decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243
  5. 662939Family b.23.3.1: Acetamidase/Formamidase-like [141131] (1 protein)
    Pfam PF03069
  6. 662940Protein Putative acetamidase TM0119 [141132] (1 species)
  7. 662941Species Thermotoga maritima [TaxId:2336] [141133] (1 PDB entry)
  8. 662944Domain d2f4lc1: 2f4l C:1-283 [132929]
    automatically matched to 2F4L A:1-283
    complexed with cl, zn

Details for d2f4lc1

PDB Entry: 2f4l (more details), 2.5 Å

PDB Description: Crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 A resolution
PDB Compounds: (C:) acetamidase, putative

SCOP Domain Sequences for d2f4lc1:

Sequence, based on SEQRES records: (download)

>d2f4lc1 b.23.3.1 (C:1-283) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
mkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfskvnpatgpvfvng
vkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripih
pmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgd
gevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfi
qrrktipftdaymlaslsvdvgisqlvnpaktakaripkyift

Sequence, based on observed residues (ATOM records): (download)

>d2f4lc1 b.23.3.1 (C:1-283) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
mkvvpaqrcvysfsanmapveevypgeqvvfetldalggsskvnpatgpvfvngvkpgdt
lkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvi
gvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvs
acevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrkti
pftdaymlaslsvdvgisqlvnpaktakaripkyift

SCOP Domain Coordinates for d2f4lc1:

Click to download the PDB-style file with coordinates for d2f4lc1.
(The format of our PDB-style files is described here.)

Timeline for d2f4lc1: