Lineage for d2f4lc2 (2f4l C:1-283)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041738Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041783Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) (S)
    decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243
  5. 2041784Family b.23.3.1: Acetamidase/Formamidase-like [141131] (1 protein)
    Pfam PF03069
  6. 2041785Protein Putative acetamidase TM0119 [141132] (1 species)
  7. 2041786Species Thermotoga maritima [TaxId:2336] [141133] (1 PDB entry)
    Uniprot Q9WXX3 1-283
  8. 2041789Domain d2f4lc2: 2f4l C:1-283 [132929]
    Other proteins in same PDB: d2f4lb3, d2f4lc3, d2f4ld3
    automated match to d2f4la1
    complexed with cl, zn

Details for d2f4lc2

PDB Entry: 2f4l (more details), 2.5 Å

PDB Description: Crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 A resolution
PDB Compounds: (C:) acetamidase, putative

SCOPe Domain Sequences for d2f4lc2:

Sequence, based on SEQRES records: (download)

>d2f4lc2 b.23.3.1 (C:1-283) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
mkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfskvnpatgpvfvng
vkpgdtlkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripih
pmvgvigvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgd
gevcvsacevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfi
qrrktipftdaymlaslsvdvgisqlvnpaktakaripkyift

Sequence, based on observed residues (ATOM records): (download)

>d2f4lc2 b.23.3.1 (C:1-283) Putative acetamidase TM0119 {Thermotoga maritima [TaxId: 2336]}
mkvvpaqrcvysfsanmapveevypgeqvvfetldalggsskvnpatgpvfvngvkpgdt
lkvrikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvi
gvapqegeyptgtahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvs
acevpakvvveidvskeeikwpvvetndayyiivslpdieealkevtretvwfiqrrkti
pftdaymlaslsvdvgisqlvnpaktakaripkyift

SCOPe Domain Coordinates for d2f4lc2:

Click to download the PDB-style file with coordinates for d2f4lc2.
(The format of our PDB-style files is described here.)

Timeline for d2f4lc2: