SCOPe 2.05: Domain d2f4id_: 2f4i D:

Lineage for d2f4id_ (2f4i D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.11: TM0957-like [141318] (1 family)
   extra N-terminal region and large insertion after strand 3 together form an alpha-helical subdomain
   automatically mapped to Pfam PF10054

5. Family b.40.11.1: TM0957-like [141319] (1 protein)

6. Protein Hypothetical protein TM0957 [141320] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141321] (1 PDB entry)
   Uniprot Q9X052 39-214

8. Domain d2f4id_: 2f4i D: [132926]
   automated match to d2f4ia1
   complexed with cl, mg

Details for d2f4id_

PDB Entry: 2f4i, 2.25 Å

PDB Description: crystal structure of an ob-fold protein (tm0957) from thermotoga maritima msb8 at 1.90 a resolution

PDB Compounds: (D:) hypothetical protein TM0957

SCOPe Domain Sequences for d2f4id_:

Sequence; same for both SEQRES and ATOM records:

>d2f4id_ b.40.11.1 (D:) Hypothetical protein TM0957 {Thermotoga maritima [TaxId: 2336]}
fdpkryarelwfklqdmmneglgydavevlntldenpelahqkfakvvgvsnyryyiiqg
vgeiveikddgilvkvrenrkvpdlflsnhifgngivnatgiakmedfdriidfnltate
lnkivkeevvnsflkqlskgagsvgslvrfiavftllkdeeikypieaiplyleiq

Timeline for d2f4id_:

• d2f4id_ first appeared in SCOP 1.73, called d2f4id1
  
• d2f4id_ appears in SCOPe 2.04
  
• d2f4id_ appears in SCOPe 2.06
  
• d2f4id_ appears in the current release, SCOPe 2.08