Lineage for d2f4ib_ (2f4i B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791195Superfamily b.40.11: TM0957-like [141318] (1 family) (S)
    extra N-terminal region and large insertion after strand 3 together form an alpha-helical subdomain
    automatically mapped to Pfam PF10054
  5. 2791196Family b.40.11.1: TM0957-like [141319] (1 protein)
  6. 2791197Protein Hypothetical protein TM0957 [141320] (1 species)
  7. 2791198Species Thermotoga maritima [TaxId:2336] [141321] (1 PDB entry)
    Uniprot Q9X052 39-214
  8. 2791200Domain d2f4ib_: 2f4i B: [132924]
    automated match to d2f4ia1
    complexed with cl, mg

Details for d2f4ib_

PDB Entry: 2f4i (more details), 2.25 Å

PDB Description: crystal structure of an ob-fold protein (tm0957) from thermotoga maritima msb8 at 1.90 a resolution
PDB Compounds: (B:) hypothetical protein TM0957

SCOPe Domain Sequences for d2f4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ib_ b.40.11.1 (B:) Hypothetical protein TM0957 {Thermotoga maritima [TaxId: 2336]}
kgfdpkryarelwfklqdmmneglgydavevlntldenpelahqkfakvvgvsnyryyii
qgvgeiveikddgilvkvrenrkvpdlflsnhifgngivnatgiakmedfdriidfnlta
telnkivkeevvnsflkqlskgagsvgslvrfiavftllkdeeikypieaiplyleiq

SCOPe Domain Coordinates for d2f4ib_:

Click to download the PDB-style file with coordinates for d2f4ib_.
(The format of our PDB-style files is described here.)

Timeline for d2f4ib_: